PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00083997001
Common NameGSBRNA2T00083997001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 336aa    MW: 37880.7 Da    PI: 8.0209
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00083997001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.17e-37104163261
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                          ++k+l+cprC+s +tkfCyynny++sqPr+fC+ C+ryWt GG++r vPvG+grrknk +
  GSBRNA2T00083997001 104 PDKILPCPRCNSGDTKFCYYNNYNVSQPRHFCRHCQRYWTSGGSMRSVPVGSGRRKNKGW 163
                          7899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-28104161IPR003851Zinc finger, Dof-type
PfamPF027011.0E-30106161IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.071108162IPR003851Zinc finger, Dof-type
PROSITE patternPS013610110146IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MSELRDTPIK LFGWTITSSL SPVLKDSSDH SMEYSSSSSF PSLGLHIMNN QSATDNSEQD  60
ITSLNISSDL NKESKETSEN SYDQHSEITT TTTSEEKTTE LKKPDKILPC PRCNSGDTKF  120
CYYNNYNVSQ PRHFCRHCQR YWTSGGSMRS VPVGSGRRKN KGWVSTDNYK HISSENNDYN  180
SSSTKILSFE SSDSCISAKG KHQPSDSNIT KYSVSQDFKK FHGFLPVQVT SSVSPPWPYH  240
QYPLNPSFYH IPVYWGYTVP VSSTLETSTC LGKRTRDELH TKMLESKDTS VRARLDSPSE  300
SINDDVSVED RATQQRATTG RACNVKHTLR RREIQ*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00083997001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893851e-163AC189385.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB052E19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009110034.10.0PREDICTED: dof zinc finger protein DOF1.3-like
SwissprotQ9LQX41e-132DOF13_ARATH; Dof zinc finger protein DOF1.3
TrEMBLA0A078IB040.0A0A078IB04_BRANA; BnaA08g19870D protein
STRINGBra016286.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM140821624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26790.11e-122Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]